{"product_id":"proteintech-31191-1-ap","title":"Proteintech, 31191-1-AP, COBLL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COBLL1 (31191-1-AP) by Proteintech is a Polyclonal antibody targeting COBLL1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n31191-1-AP targets COBLL1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells\nPositive IHC detected in: mouse kidney tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HaCaT cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCordon-blue protein-like 1 (COBLL1), a negative regulator of apoptosis, is associated with lower insulin resistance. COBLL1 is involved in the cancer cell morphogenesis to a neuron-like cell shape observed in the CRPC model cells, promoting cell growth and migration (PMID: 29686105, 29686105). COBLL1 is highly expressed in most human tissues including lung, liver, kidney, pancreas, ovary, spinal cord and brain.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34853 Product name: Recombinant human COBLL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 990-1128 aa of BC071588 Sequence: LAVVKRSQSFSKERTESPSASALVQPPANTEEGKTHSVNKFVDIPQLGVSDKENNSAHNEQNSQIPTPTDGPSFTVMRQSSLTFQSSDPEQMRQSLLTAIRSGEAAAKLKRVTIPSNTISVNGRSRLSHSMSPDAQDGH Predict reactive species\nFull Name: COBL-like 1\nObserved Molecular Weight: 160 kDa\nGenBank Accession Number: BC071588\nGene Symbol: COBLL1\nGene ID (NCBI): 22837\nRRID: AB_3669891\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q53SF7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886715850921,"sku":"31191-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31191-1-ap","provider":"Iright","version":"1.0","type":"link"}