{"product_id":"proteintech-31196-1-ap","title":"Proteintech, 31196-1-AP, S100a10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe S100a10 (31196-1-AP) by Proteintech is a Polyclonal antibody targeting S100a10 in WB, ELISA applications with reactivity to human, mouse samples\n31196-1-AP targets S100a10 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HaCaT cells, RAW 264.7 cells,  mouse lung tissue,  mouse spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nS100A10 (also known as p11) is a member of the S100 family of EF-hand-type Ca2+-binding proteins and participates in various biological processes . The overexpression of S100A10 and S100A2 in CRCs may be used for prognosis assessment in relapse CRCs after adjuvant 5-fluorouracil (5-Fu) therapy and radical surgery. S100A10 usually associates with annexin A2 (ANXA2, p36) to form a heterotetramer complex (AIIt) and is mainly localized to the cell membrane and cytoplasm. (PMID: 34336846)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35034 Product name: Recombinant mouse S100a10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-97 aa of NM_009112 Sequence: MPSQMEHAMETMMLTFHRFAGDKDHLTKEDLRVLMEREFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFLSLVAGLTIACNDYFVVNMKQKGKK Predict reactive species\nFull Name: S100 calcium binding protein A10 (calpactin)\nCalculated Molecular Weight: 11 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: NM_009112\nGene Symbol: S100a10\nGene ID (NCBI): 20194\nRRID: AB_3669895\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P08207\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887791296681,"sku":"31196-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31196-1-ap","provider":"Iright","version":"1.0","type":"link"}