{"product_id":"proteintech-31201-1-ap","title":"Proteintech, 31201-1-AP, PSMG4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSMG4 (31201-1-AP) by Proteintech is a Polyclonal antibody targeting PSMG4 in WB, ELISA applications with reactivity to human samples\n31201-1-AP targets PSMG4 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, MCF-7 cells,  MDA-MB-231 cells,  SK-BR-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPSMG4 (Proteasome assembly chaperone 4), also known as C6orf86. It is expected to be located in the nucleus and cytoplasm, which interacts with PSMG3 and asociates with alpha subunits of the 20S proteasome. The molecular weight of PSMG4 is 13 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35222 Product name: Recombinant human PSMG4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-123 aa of NM_001128591.1 Sequence: MEGLVVAAGGDVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRYDSIPVSTSLLGDTSDTTSTGLAQRLARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFPEKF Predict reactive species\nFull Name: proteasome (prosome, macropain) assembly chaperone 4\nCalculated Molecular Weight: 14 kDa\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: NM_001128591.1\nGene Symbol: PSMG4\nGene ID (NCBI): 389362\nRRID: AB_3669898\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q5JS54\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887776452777,"sku":"31201-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31201-1-ap","provider":"Iright","version":"1.0","type":"link"}