{"product_id":"proteintech-31203-1-ap","title":"Proteintech, 31203-1-AP, SEMG2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SEMG2 (31203-1-AP) by Proteintech is a Polyclonal antibody targeting SEMG2 in IHC, ELISA applications with reactivity to human, mouse samples\n31203-1-AP targets SEMG2 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSEMG2 genes belong to the family of cancer-testis antigens (CTAs), whose expression normally is restricted to male germ cells but is often restored in various malignancies. SEMGs were found expressed in various malignancies including prostate, lung, and renal carcinoma, as well as in some blood neoplasms (PMID: 33311447).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35285 Product name: Recombinant human SEMG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 490-582 aa of NM_003008.2 Sequence: SQSSISFQIEKLVEGKSQIQTPNPNQDQWSGQNAKGKSGQSADSKQDLLSHEQKGRYKQESSESHNIVITEHEVAQDDHLTQQYNEDRNPIST Predict reactive species\nFull Name: semenogelin II\nCalculated Molecular Weight: 65kDa，582aa\nGenBank Accession Number: NM_003008.2\nGene Symbol: SEMG2\nGene ID (NCBI): 6407\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q02383\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887796474025,"sku":"31203-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31203-1-ap","provider":"Iright","version":"1.0","type":"link"}