{"product_id":"proteintech-31205-1-ap","title":"Proteintech, 31205-1-AP, CLK4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLK4 (31205-1-AP) by Proteintech is a Polyclonal antibody targeting CLK4 in WB, ELISA applications with reactivity to human, mouse samples\n31205-1-AP targets CLK4 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: EC109 cells, K-562 cells,  mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCDC-like kinase 4 (CLK4) is a dual-specificity kinase that can phosphorylate the tyrosine or serine\/threonine residues of substrates. CLK4 belongs to the LAMMER kinase family, which includes three other characterised isoforms: CLK1-3. CLK2 and CLK4 are essential regulators of DNA damage-induced IKK and NF-κB activity (PMID: 37506701).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34446 Product name: Recombinant human CLK4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 10-130 aa of NM_020666 Sequence: PDWDSRESWGHESYRGSHKRKRRSHSSTQENRHCKPHHQFKESDCHYLEARSLNERDYRDRRYVDEYRNDYCEGYVPRHYHRDIESGYRIHCSKSSVRSRRSSPKRKRNRHCSSHQSRSKS Predict reactive species\nFull Name: CDC-like kinase 4\nCalculated Molecular Weight: 57 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: NM_020666\nGene Symbol: CLK4\nGene ID (NCBI): 57396\nRRID: AB_3669900\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9HAZ1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886621741225,"sku":"31205-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31205-1-ap","provider":"Iright","version":"1.0","type":"link"}