{"product_id":"proteintech-31221-1-ap","title":"Proteintech, 31221-1-AP, CDKN2A\/P14-ARF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDKN2A\/P14-ARF (31221-1-AP) by Proteintech is a Polyclonal antibody targeting CDKN2A\/P14-ARF in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n31221-1-AP targets CDKN2A\/P14-ARF in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCDKN2A locus on chromosome 9p21 encodes two transcripts\/proteins INK4A and ARF. INK4A (also referred to as p16INK4A) specially blocks the CDK4 and CDK6 cyclin-dependent kinases that control the phosphorylation status of the retinoblastoma (RB) protein (PMID: 11584300, PMID: 8259215). ARF (known as p14ARF in human and p19ARF in mouse) has been designed as a positive regulator of p53 levels because, through its complexation with Mdm2 (HDM2 in human), it prevents mdm2-mediated cytoplasmic translocation and degradation of p53 (PMID: 9153396).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33340 Product name: Recombinant human ARF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-132 aa of NM_058195 Sequence: MVRRFLVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPGHDDGQRPSGGAAAAPRRGAQLRRPRHSHPTRARRCPGGLPGHAGGAAPGRGAAGRARCLGPSARGPG Predict reactive species\nFull Name: cyclin-dependent kinase inhibitor 2A\nCalculated Molecular Weight: 14kd\nObserved Molecular Weight: 14 kDa, 19 kDa\nGenBank Accession Number: NM_058195\nGene Symbol: CDKN2A\nGene ID (NCBI): 1029\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N726\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886406684841,"sku":"31221-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31221-1-ap","provider":"Iright","version":"1.0","type":"link"}