{"product_id":"proteintech-31264-1-ap","title":"Proteintech, 31264-1-AP, FOLR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FOLR2 (31264-1-AP) by Proteintech is a Polyclonal antibody targeting FOLR2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n31264-1-AP targets FOLR2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-1080 cells, Jurkat cells,  MCF-7 cells,  Raji cells,  Ramos cells\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFOLR2 (Folate Receptor 2), also known as Folate Receptor beta (FR-beta), is a 38 kDa glycoprotein that is anchored to the cell membrane via glycosyl phosphatidylinositol (GPI) linkage . FOLR2 belongs to the folate receptor (FOLR) family, which also includes FOLR1 (FR-α), FOLR3 (FR-γ), and FOLR4. FOLR2 has been shown to be expressed by malignant cells, including myelogenous leukemia cells, but has also been demonstrated to be mainly expressed by tumor-associated macrophages (TAMs).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg0953 Product name: recombinant human FOLR2 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 17-228 aa of NM_000803.5 Sequence: TMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMH Predict reactive species\nFull Name: folate receptor 2 (fetal)\nCalculated Molecular Weight: 29KD\nObserved Molecular Weight: 33-35 kDa\nGenBank Accession Number: NM_000803.5\nGene Symbol: FOLR2\nGene ID (NCBI): 2350\nRRID: AB_3669922\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P14207\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869684682921,"sku":"31264-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31264-1-ap","provider":"Iright","version":"1.0","type":"link"}