{"product_id":"proteintech-31293-1-ap","title":"Proteintech, 31293-1-AP, TMEM189 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM189 (31293-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM189 in IHC, ELISA applications with reactivity to human samples\n31293-1-AP targets TMEM189 in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM189 (Plasmanylethanolamine desaturase 1), also known as PEDS1. It is predicted to be located in the endoplasmic reticulum membrane. Plasmalogens are glycerophospholipids with a hydrocarbon chain linked by a vinyl ether bond at the glycerol sn-1 position, and are involved in antioxidative and signaling mechanisms (PMID: 31604315). The molecular weight of TMEM189 is 31 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34323 Product name: Recombinant human TMEM189 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 182-270 aa of BC142966 Sequence: TNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK Predict reactive species\nFull Name: transmembrane protein 189\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: BC142966\nGene Symbol: TMEM189\nGene ID (NCBI): 387521\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: A5PLL7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887831240873,"sku":"31293-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31293-1-ap","provider":"Iright","version":"1.0","type":"link"}