{"product_id":"proteintech-31363-1-ap","title":"Proteintech, 31363-1-AP, DFNA5\/GSDME Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DFNA5\/GSDME (31363-1-AP) by Proteintech is a Polyclonal antibody targeting DFNA5\/GSDME in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n31363-1-AP targets DFNA5\/GSDME in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, A549 cells,  mouse brain tissue\nPositive IP detected in: SH-SY5Y cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDFNA5 (deafness, autosomal dominant 5), also known as GSDME or ICERE-1, is a 496 amino acid protein that is expressed in cochlea tissue, as well as in placenta, brain, heart, liver, lung and pancreas. Defects in the gene encoding DFNA5 are the cause of non-syndromic sensorineural deafness autosomal dominant type 5 (DFNA5), a form of sensorineural hearing loss that results from damage to one of various structures that receive sound information in the brain. GSDME produced two GSDME fragments with MW of 35 kDa and 25 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35186 Product name: Recombinant human DFNA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 90-190 aa of BC019689 Sequence: NVTKDSNVVLEIPAATTIAYGVIELYVKLDGQFEFCLLRGKQGGFENKKRIDSVYLDPLVFREFAFIDMPDAAHGISSQDGPLSVLKQATLLLERNFHPFA Predict reactive species\nFull Name: deafness, autosomal dominant 5\nCalculated Molecular Weight: 496 aa, 55 kDa\nObserved Molecular Weight: 55 kDa, 35 kDa, 25 kDa\nGenBank Accession Number: BC019689\nGene Symbol: DFNA5\nGene ID (NCBI): 1687\nRRID: AB_3669957\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O60443\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887182762153,"sku":"31363-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31363-1-ap","provider":"Iright","version":"1.0","type":"link"}