{"product_id":"proteintech-31369-1-ap","title":"Proteintech, 31369-1-AP, HTRA3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HTRA3 (31369-1-AP) by Proteintech is a Polyclonal antibody targeting HTRA3 in WB, ELISA applications with reactivity to human samples\n31369-1-AP targets HTRA3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SK-N-SH cells, Saos-2 cells,  U-87 MG cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHTRA3 is one of the four members of the HtrA family proteins, with a secreted multidomain and serine protease activity, which plays an important role in cellular stress response, protein homeostasis, and apoptosis. HTRA3 is highly expressed in the decidual cells in the late secretory phase of the menstrual cycle and throughout pregnancy, and in most trophoblast cell types, apart from the invading interstitial trophoblast during the first trimester. HTRA3 and its family members are down-regulated in several cancers and are proposed as tumor suppressors (PMID: 21321049, 22229724).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35448 Product name: Recombinant human HTRA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 337-453 aa of NM_053044.4 Sequence: ITRFLTEFQDKQIKDWKKRFIGIRMRTITPSLVDELKASNPDFPEVSSGIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSSELQEAVLTESPLLLEVRRGNDDLLFSIAPEVVM Predict reactive species\nFull Name: HtrA serine peptidase 3\nCalculated Molecular Weight: 49kDa，453aa\nObserved Molecular Weight: 49 kDa\nGenBank Accession Number: NM_053044.4\nGene Symbol: HTRA3\nGene ID (NCBI): 94031\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P83110\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887673528489,"sku":"31369-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31369-1-ap","provider":"Iright","version":"1.0","type":"link"}