{"product_id":"proteintech-31393-1-ap","title":"Proteintech, 31393-1-AP, GNG7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNG7 (31393-1-AP) by Proteintech is a Polyclonal antibody targeting GNG7 in WB, ELISA applications with reactivity to Mouse, Rat samples\n31393-1-AP targets GNG7 in WB, ELISA applications and shows reactivity with Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGNG7 belongs to the large guanine nucleotide binding protein γ family and is located on chromosome 19. Related genes of the G protein family are involved in various transmembrane signaling transduction pathways. GNG7 may be associated with transmembrane signaling pathways and involved in cell contact-induced growth arrest, thus repressing uncontrolled cell proliferation in multicellular organisms. GNG7 is a heterotrimeric G protein subunit with ubiquitous expression in various tissues but low expression in cancer. GNG7 overexpression inhibited cell growth and tumorigenicity of esophageal carcinoma cells. Also, GNG7 was confirmed as an essential autophagy-inducing agent and participated in inhibiting tumor progression through mTOR pathway (PMID: 30864685, 35281820, 36159963).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Mouse, Rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34754 Product name: Recombinant human GNG7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC014466 Sequence: MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL Predict reactive species\nFull Name: guanine nucleotide binding protein (G protein), gamma 7\nCalculated Molecular Weight: 8 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC014466\nGene Symbol: GNG7\nGene ID (NCBI): 2788\nRRID: AB_3669962\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O60262\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887653998761,"sku":"31393-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31393-1-ap","provider":"Iright","version":"1.0","type":"link"}