{"product_id":"proteintech-31399-1-ap","title":"Proteintech, 31399-1-AP, Cathepsin B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cathepsin B (31399-1-AP) by Proteintech is a Polyclonal antibody targeting Cathepsin B in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n31399-1-AP targets Cathepsin B in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, HepG2 cells,  RAW 264.7 cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCTSB(Cathepsin B) is also named as CPSB and belongs to the peptidase C1 family. It participates in intracellular degradation and turnover of proteins. Cathepsin B precursors found in human malignant ascites fluid do not possess mannose-rich carbohydrates suggesting that a defect in the post translational processing of carbohydrate moieties on tumor. Cathepsin B exists as both glycosylated and unglycosylated forms(PMID:1637335). In rat macrophages and hepatocytes pro- cathepsin B is 39 kDa (unglycosylated =35 kDa), whereas in human fibroblasts procathepsin B is 44.5-46kDa (unglycosylated=39kDa)(PMID:2097084). It can be detected the 43 kDa form of pro-CTSB,  31 kDa and 25 kDa mature forms in mouse brain by western blot(PMID:20616152).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg1020 Product name: Recombinant Human Cathepsin B protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-10*His Domain: 18-339 aa of NM_001908.5 Sequence: RSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI Predict reactive species\nFull Name: cathepsin B\nCalculated Molecular Weight: 38kDa\nObserved Molecular Weight: 25 kDa and 31 kDa\nGenBank Accession Number: NM_001908.5\nGene Symbol: Cathepsin B\nGene ID (NCBI): 1508\nRRID: AB_3669964\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P07858\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885841338537,"sku":"31399-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31399-1-ap","provider":"Iright","version":"1.0","type":"link"}