{"product_id":"proteintech-31405-1-ap","title":"Proteintech, 31405-1-AP, PDCD11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PDCD11 (31405-1-AP) by Proteintech is a Polyclonal antibody targeting PDCD11 in WB, ELISA applications with reactivity to human samples\n31405-1-AP targets PDCD11 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cell\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPDCD11, also known as ALG-4, RRP5, or NFBP, possesses a series of S1 RNA-binding domains in the N-terminus with approximately 1,400 amino acids, followed by a tetratricopeptide repeat (TPR) domain in the C-terminus. Through S1 N-terminal domains, PDCD11 interacts with pre-rRNA to coordinate rRNA processing and assembly in the nucleolus. It also binds to Exonuclease-1 and upregulates Fas to induce cell apoptosis. Recently, PDCD11 was proved to interact with NF-κB subunits to suppress the expression of inflammatory cytokines and activate the TGFβ1 pathway, thereby modulating microglia differentiation during zebrafish development.(PMID: 38062028)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35402 Product name: Recombinant human PDCD11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1290-1480 aa of BC049838 Sequence: DNVLTLSLRSSRTNPETKSKVEDPEINSIQDIKEGQLLRGYVGSIQPHGVFFRLGPSVVGLARYSHVSQHSPSKKALYNKHLPEGKLLTARVLRLNHQKNLVELSFLPGDTGKPDVLSASLEGQLTKQEERKTEAEERDQKGEKKNQKRNEKKNQKGQEEVEMPSKEKQQPQKPQAQKRGGRECRESGSEQ Predict reactive species\nFull Name: programmed cell death 11\nObserved Molecular Weight: 209 kDa\nGenBank Accession Number: BC049838\nGene Symbol: PDCD11\nGene ID (NCBI): 22984\nRRID: AB_3669967\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q14690\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887754694825,"sku":"31405-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31405-1-ap","provider":"Iright","version":"1.0","type":"link"}