{"product_id":"proteintech-31429-1-ap","title":"Proteintech, 31429-1-AP, SLC2A4RG Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC2A4RG (31429-1-AP) by Proteintech is a Polyclonal antibody targeting SLC2A4RG in WB, ELISA applications with reactivity to human samples\n31429-1-AP targets SLC2A4RG in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, PC-3 cells,  U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC2A4RG, or SLC2A4 Regulator, is a nuclear transcription factor that plays a role in activating the solute carrier family 2 member 4 gene, also known as GLUT4. SLC2A4RG has been implicated in the transcriptional regulation of genes, including its interaction with a 7-bp consensus sequence (GCCGGCG), which is an essential cis-regulatory element for Huntington's disease (HD) gene expression in neuronal cells. The SLC2A4RG protein is involved in the modulation of SLC2A4 expression and has been identified as a transcription factor that binds specifically to the promoter region of SLC2A4. It is also known to interact with another transcription factor, myocyte enhancer factor 2 (MEF2), to activate the transcription of SLC2A4. SLC2A4RG is expressed ubiquitously in various tissues, with higher expression levels observed in fat and kidney tissues.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35675 Product name: Recombinant human SLC2A4RG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 200-350 aa of NM_020062.3 Sequence: FQCLWKSCGKVLSTASAMQRHIRLVHLGRQAEPEQSDGEEDFYYTELDVGVDTLTDGLSSLTPVSPTASMPPAFPRLELPELLEPPALPSPLRPPAPPLPPPPVLSTVANPQSCHSDRVYQGCLTPARLEPQPTEVGACPPALSSRIGVTL Predict reactive species\nFull Name: SLC2A4 regulator\nCalculated Molecular Weight: 41kDa，387aa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: NM_020062.3\nGene Symbol: SLC2A4RG\nGene ID (NCBI): 56731\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9NR83\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887805911209,"sku":"31429-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31429-1-ap","provider":"Iright","version":"1.0","type":"link"}