{"product_id":"proteintech-31436-1-ap","title":"Proteintech, 31436-1-AP, SLC35B3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC35B3 (31436-1-AP) by Proteintech is a Polyclonal antibody targeting SLC35B3 in WB, ELISA applications with reactivity to human samples\n31436-1-AP targets SLC35B3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells, MCF-7 cells,  MDA-MB-231 cells,  U2OS cells,  MG-63 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC35B3 (solute carrier family 35 member B3) is a member of the solute carrier family. SLC35B3 is involved in transporting 3-prime phosphoadenosine 5-prime phosphosulfate (PAPS) from the nucleus or the cytosol to the Golgi lumen. The observed MW of SLC35B3 is 40 kDa and 32 kDa, which is due to alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34349 Product name: Recombinant human SLC35B3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-77 aa of BC006973 Sequence: MDLTQQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGMNLSKFNK Predict reactive species\nFull Name: solute carrier family 35, member B3\nCalculated Molecular Weight: 401 aa, 45 kDa\nObserved Molecular Weight: 40, 32 kDa\nGenBank Accession Number: BC006973\nGene Symbol: SLC35B3\nGene ID (NCBI): 51000\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9H1N7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887806140585,"sku":"31436-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31436-1-ap","provider":"Iright","version":"1.0","type":"link"}