{"product_id":"proteintech-31447-1-ap","title":"Proteintech, 31447-1-AP, CD155\/PVR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD155\/PVR (31447-1-AP) by Proteintech is a Polyclonal antibody targeting CD155\/PVR in WB, IHC, IF\/ICC, ELISA applications with reactivity to mouse samples\n31447-1-AP targets CD155\/PVR in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: RAW 264.7 cells, mouse liver tissue,  mouse small intestine tissue\nPositive IHC detected in: mouse liver tissue, mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD155, also known as the poliovirus receptor (PVR) or Necl-5, is one of the nectin-like family members, belonging to the Ca2+ independent immunoglobulin superfamily (IgSF) in cell adhesion molecules (PMID: 37660884). CD155 is a type I transmembrane protein composed of three extracellular immunoglobulin-like domains, a transmembrane domain, and a cytoplasmic tail. It is involved in cell-to-cell and cell-to-ECM adhesion (PMID: 32019260; 11437656). CD155 acts as a ligand for immune receptors, including TIGIT, CD96 and CD226, which are expressed on T cells and NK cells. CD155 interacts with these receptors to modulate immune responses, such as T cell activation and NK cell-mediated cytotoxicity (PMID: 37660884). CD155 serves as the entry receptor for poliovirus and thereby mediates susceptibility to poliovirus infection (PMID: 15034010).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg0903 Product name: Recombinant Mouse CD155\/PVR protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 29-348 aa of NM_027514.2 Sequence: DIRVLVPYNSTGVLGGSTTLHCSLTSNENVTITQITWMKKDSGGSHALVAVFHPKKGPNIKEPERVKFLAAQQDLRNASLAISNLSVEDEGIYECQIATFPRGSRSTNAWLKVQARPKNTAEALEPSPTLILQDVAKCISANGHPPGRISWPSNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTVEHESLQELDQLLVTLSQPYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMAGYNWSTNTGDFPNSVKRQGNMLLISTVEDGLNNTVIVCEVTNALGSGQGQVHIIVKEKPENMQQNTRLHL Predict reactive species\nFull Name: poliovirus receptor\nCalculated Molecular Weight: 45 kDa\nObserved Molecular Weight: 75-85 kDa\nGenBank Accession Number: NM_027514.2\nGene Symbol: CD155\/PVR\nGene ID (NCBI): 52118\nRRID: AB_3669988\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8K094\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869652340905,"sku":"31447-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31447-1-ap","provider":"Iright","version":"1.0","type":"link"}