{"product_id":"proteintech-31458-1-ap","title":"Proteintech, 31458-1-AP, PDIA2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PDIA2 (31458-1-AP) by Proteintech is a Polyclonal antibody targeting PDIA2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n31458-1-AP targets PDIA2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse pancreas tissue, rat pancreas tissue\nPositive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPDIA2 (Protein disulfide-isomerase A2), a member of PDI family, is an ER protein chaperone that catalyzes the formation and breakage of disulfide bonds between cysteine residues and can inhibit aggregation of misfolded proteins by catalyzing rearrangement of -S-S- bonds in proteins. (PMID: 23486466)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35301 Product name: Recombinant human PDIA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 231-390 aa of NM_006849.2 Sequence: RADFPVDEELGLDLGDLSRFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLAGFGEAAPRFRGQVLFVVVDVAADNEHVLQYFGLKAEAAPTLRLVNLETTKKYAPVDGGPVTAASITAFCHAVLNGQVKPYLLSQEIPPDWDQRPV Predict reactive species\nFull Name: protein disulfide isomerase family A, member 2\nCalculated Molecular Weight: 58 kDa\nObserved Molecular Weight: 60-65 kDa\nGenBank Accession Number: NM_006849.2\nGene Symbol: PDIA2\nGene ID (NCBI): 64714\nRRID: AB_3669994\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q13087\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887755415721,"sku":"31458-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31458-1-ap","provider":"Iright","version":"1.0","type":"link"}