{"product_id":"proteintech-31464-1-ap","title":"Proteintech, 31464-1-AP, E2F6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe E2F6 (31464-1-AP) by Proteintech is a Polyclonal antibody targeting E2F6 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n31464-1-AP targets E2F6 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, K-562 cells\nPositive IF\/ICC detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nE2F6 is a member of the E2F family of TFs that control cell proliferation and cell fate. Cancer patients with high E2F6 expression in tumors, such as glioblastoma, breast cancer, and hepatocellular carcinoma, have poor prognosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35112 Product name: Recombinant human E2F6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 232-281 aa of BC008348 Sequence: DVYLCEVEQGQTSNKRSEGVGTSSSESTHPEGPEEEENPQQSEELLEVSN Predict reactive species\nFull Name: E2F transcription factor 6\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 35-40 kDa\nGenBank Accession Number: BC008348\nGene Symbol: E2F6\nGene ID (NCBI): 1876\nRRID: AB_3669998\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O75461\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887399063721,"sku":"31464-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31464-1-ap","provider":"Iright","version":"1.0","type":"link"}