{"product_id":"proteintech-31492-1-ap","title":"Proteintech, 31492-1-AP, DNAJC13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DNAJC13 (31492-1-AP) by Proteintech is a Polyclonal antibody targeting DNAJC13 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n31492-1-AP targets DNAJC13 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  NIH\/3T3 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDNAJC13 is a large protein with 2,243 amino acids. Due to the presence of the central DNAJ domain, DNAJC13 binds HSC70 (heat shock cognate 70) and acts as a co-chaperone in mediating HSC70 cellular functions. Within the cell, DNAJC13 is primarily localized at membranous structures. This interaction is mediated, at least in part, by the binding to phosphoinositides (PI) through its N-terminal sequence. RME-8\/DNAJC13 is involved in several endosomal functions such as protein sorting, endosomal tubulation, transport processes including the retrograde transport from the endosome to the trans-Golgi network (TGN), the formation of endosomal degradative microdomains, and the recycling of membrane receptors. (PMID: 32322926)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35412 Product name: Recombinant human DNAJC13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1300-1400 aa of BC043583 Sequence: DDAYEVLNLPQGQGPHDESKIRKAYFRLAQKYHPDKNPEGRDMFEKVNKAYEFLCTKSAKIVDGPDPENIILILKTQSILFNRHKEDLQPYKYAGYPMLIR Predict reactive species\nFull Name: DnaJ (Hsp40) homolog, subfamily C, member 13\nObserved Molecular Weight: 254 kDa\nGenBank Accession Number: BC043583\nGene Symbol: DNAJC13\nGene ID (NCBI): 23317\nRRID: AB_3670005\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O75165\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869675147433,"sku":"31492-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31492-1-ap","provider":"Iright","version":"1.0","type":"link"}