{"product_id":"proteintech-31525-1-ap","title":"Proteintech, 31525-1-AP, TMEM258 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM258 (31525-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM258 in WB, IHC, ELISA applications with reactivity to human samples\n31525-1-AP targets TMEM258 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, PC-3 cells,  SH-SY5Y cells,  U2OS cells\nPositive IHC detected in: mouse kidney tissue, mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM258, or transmembrane protein 258, is a component of the oligosaccharyltransferase (OST) complex. Research has shown that TMEM258 is involved in controlling ER stress and intestinal inflammation. In particular, it has been identified as a central regulator of intestinal homeostasis. The loss of TMEM258 leads to unresolved ER stress, which can result in apoptosis (PMID: 27974209). The calculated MW is 9 kDa,  The observed MW is multiple bands, which may be caused by Glycosylation modification.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35142 Product name: Recombinant human TMEM258 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-54 aa of BC015968 Sequence: MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKEL Predict reactive species\nFull Name: chromosome 11 open reading frame 10\nObserved Molecular Weight: 10 and 16 kDa\nGenBank Accession Number: BC015968\nGene Symbol: C11orf10\nGene ID (NCBI): 746\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P61165\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887832158377,"sku":"31525-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31525-1-ap","provider":"Iright","version":"1.0","type":"link"}