{"product_id":"proteintech-31537-1-ap","title":"Proteintech, 31537-1-AP, ATPBD3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATPBD3 (31537-1-AP) by Proteintech is a Polyclonal antibody targeting ATPBD3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n31537-1-AP targets ATPBD3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, K-562 cells\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATPBD3, also known as CTU1, NCS6, is a subunit of a highly conserved protein complex involved in the thiolation of wobble U34(PMID: 18391219). ATPBD3 directly binds tRNAs and probably acts by catalyzing the adenylation of tRNAs, an intermediate required for 2-thiolation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35037 Product name: Recombinant human ATPBD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-200 aa of NM_145232 Sequence: PGAVVAVGASGGKDSTVLAHVLRALAPRLGISLQLVAVDEGIGGYRDAALAAVRRQAARWELPLTVVAYEDLFGGWTMDAVARSTAGSGRSRSCCTFCGVLRRRALEEGARRVGATHIVTGHNADDMAETVLMNFLRGDAGRLARGGGLGS Predict reactive species\nFull Name: ATP binding domain 3\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 30-36 kDa\nGenBank Accession Number: NM_145232\nGene Symbol: ATPBD3\nGene ID (NCBI): 90353\nRRID: AB_3670027\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q7Z7A3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885136924841,"sku":"31537-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31537-1-ap","provider":"Iright","version":"1.0","type":"link"}