{"product_id":"proteintech-31548-1-ap","title":"Proteintech, 31548-1-AP, LYRM5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LYRM5 (31548-1-AP) by Proteintech is a Polyclonal antibody targeting LYRM5 in IP, ELISA applications with reactivity to human, mouse samples\n31548-1-AP targets LYRM5 in IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: mouse heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLYRM5, also known as ETFRF1, belongs to the Complex1_LYR-like Superfamily. LYRM5 is a mitochondrial protein and plays key roles in acetate metabolism, and in essential Fe-S cluster biogenesis. In vitro, LYRM5 was found to inhibit ETF by promoting the removal of flavin from the ETF holoenzyme, thus potentially regulating the rate of β-oxidation (PMID: 35402183, PMID: 36266680). The calculated molecular weight of LYRM5 is 11 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35889 Product name: Recombinant human LYRM5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC071769 Sequence: MANSLRGEVLKLYKNLLYLGRDYPKGADYFKKRLKNIFLKNKDVKNPEKIKELIAQGEFVMKELEALYFLRKYRAMKQRYYSDTNKTN Predict reactive species\nFull Name: LYR motif containing 5\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: BC071769\nGene Symbol: LYRM5\nGene ID (NCBI): 144363\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q6IPR1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887710294185,"sku":"31548-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31548-1-ap","provider":"Iright","version":"1.0","type":"link"}