{"product_id":"proteintech-31553-1-ap","title":"Proteintech, 31553-1-AP, FYB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FYB (31553-1-AP) by Proteintech is a Polyclonal antibody targeting FYB in WB, IHC, ELISA applications with reactivity to human samples\n31553-1-AP targets FYB in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFYN binding protein (FYB-120\/130), also known as FYB, ADAP (Adhesion and degranulation-promoting adapter protein), and SLAP-130 (SLP-76-associated phosphoprotein) is a protein that is encoded by the FYB gene in humans. The protein is highly expressed in T cells, NK cells, bone marrow cells, and platelets, responsible for the signal transduction upon T cell receptor (TCR) stimulation with integrin activation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35929 Product name: Recombinant human FYB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 600-783 aa of NM_199335.3 Sequence: EQDDISSHSQSGSGGIFPPPPDDDIYDGIEEEDADDGFPAPPKQLDMGDEVYDDVDTSDFPVSSAEMSQGTNVGKAKTEEKDLKKLKKQEKEEKDFRKKFKYDGEIRVLYSTKVTTSITSKKWGTRDLQVKPGESLEVIQTTDDTKVLCRNEEGKYGYVLRSYLADNDGEIYDDIADGCIYDND Predict reactive species\nFull Name: FYN binding protein (FYB-120\/130)\nCalculated Molecular Weight: 85kDa，783aa\nObserved Molecular Weight: 110 kDa\nGenBank Accession Number: NM_199335.3\nGene Symbol: FYB\nGene ID (NCBI): 2533\nRRID: AB_3670034\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O15117\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887644823721,"sku":"31553-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31553-1-ap","provider":"Iright","version":"1.0","type":"link"}