{"product_id":"proteintech-31561-1-ap","title":"Proteintech, 31561-1-AP, MIC10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MIC10 (31561-1-AP) by Proteintech is a Polyclonal antibody targeting MIC10 in WB, IF\/ICC, ELISA applications with reactivity to Human, Mouse samples\n31561-1-AP targets MIC10 in WB, IF\/ICC, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, HEK-293 cells,  L02 cells,  mouse heart tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMIC10, also known as C1orf151, MICOS10, and MINOS1, belongs to the  MICOS complex subunit Mic10 family. MIC10 is a component of the MICOS complex, which is a large protein complex located in the inner membrane of mitochondria. MIC10 plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. MIC10 is also functionally connected to the F1Fo-ATP synthase (PMID: 22114354, PMID: 28315355).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34301 Product name: Recombinant human MIC10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2-78 aa of NM_001032363 Sequence: SESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ Predict reactive species\nFull Name: chromosome 1 open reading frame 151\nCalculated Molecular Weight: 9 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: NM_001032363\nGene Symbol: C1orf151\nGene ID (NCBI): 440574\nRRID: AB_3670036\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q5TGZ0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887719239849,"sku":"31561-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31561-1-ap","provider":"Iright","version":"1.0","type":"link"}