{"product_id":"proteintech-31569-1-ap","title":"Proteintech, 31569-1-AP, AIF1L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AIF1L (31569-1-AP) by Proteintech is a Polyclonal antibody targeting AIF1L in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n31569-1-AP targets AIF1L in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, MCF-7 cells,  mouse kidney tissue,  rat kidney tissue\nPositive IF-P detected in: mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAIF1L is a homolog to the allograft inflammatory factor 1 (AIF1 or IBA1), sharing up to 60% sequence homology. Previous work could demonstrate that AIF1L and AIF1 show actin bundling and cross-linking function, co-localization, and-sedimentation with F-actin. More recently, increased expression levels for AIF1L were reported in cases of breast cancer and functionally related to increased proliferation rates via upregulation of cyclin D1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36216 Product name: Recombinant human AIF1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-69 aa of BC021253 Sequence: MSGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDL Predict reactive species\nFull Name: allograft inflammatory factor 1-like\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC021253\nGene Symbol: AIF1L\nGene ID (NCBI): 83543\nRRID: AB_3670038\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9BQI0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869805858985,"sku":"31569-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31569-1-ap","provider":"Iright","version":"1.0","type":"link"}