{"product_id":"proteintech-31572-1-ap","title":"Proteintech, 31572-1-AP, WHAMM Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WHAMM (31572-1-AP) by Proteintech is a Polyclonal antibody targeting WHAMM in WB, ELISA applications with reactivity to human samples\n31572-1-AP targets WHAMM in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWHAMM (WASP homolog associated with actin, golgi membranes and microtubules), also known as WHDC1. It is expected to be located in the cytoplasm, which is enriched in brain, lung, heart, colon and kidney. WHAMM is involved in Golgi membrane association, microtubule binding, and actin nucleation as a nucleation-promoting factor, which activates the actin-related protein 2\/3 complex (the Arp2\/ 3 complex) (PMID: 23160625). It is reported that the nucleation-promoting factor (NPF) WHAMM recruits and activates the Arp2\/3 complex for actin assembly at sites of autophagosome formation on the ER (PMID: 26291929). The molecular weight of WHAMM is 90 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36160 Product name: Recombinant human WHAMM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 660-809 aa of BC167774 Sequence: RALSSSSQAATHQNLGFRAPVKDDQPRPLVCESPAERPRDSLESFSCPGSMDEVLASLRHGRAPLRKVEVPAVRPPHASINEHILAAIRQGVKLKKVHPDLGPNPSSKPTSNRRTSDLERSIKAALQRIKRVSADSEEDSDEQDPGQWDG Predict reactive species\nFull Name: WAS protein homolog associated with actin, golgi membranes and microtubules\nObserved Molecular Weight: 90-100 kDa\nGenBank Accession Number: BC167774\nGene Symbol: WHAMM\nGene ID (NCBI): 123720\nRRID: AB_3670039\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8TF30\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887923613865,"sku":"31572-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31572-1-ap","provider":"Iright","version":"1.0","type":"link"}