{"product_id":"proteintech-31624-1-ap","title":"Proteintech, 31624-1-AP, EFHD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EFHD2 (31624-1-AP) by Proteintech is a Polyclonal antibody targeting EFHD2 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n31624-1-AP targets EFHD2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, NCI-H1299 cells,  SW480 cells,  Calu-1 cells,  HCT 116 cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEF-hand domain-containing protein D2 (also known as Swiprosin-1) is a calcium-binding protein with two conserved EF-chiral coiled-coil structural domains, and it is mostly involved in calcium signaling, cytoskeleton assembly and synapse formation. EFHD2 is broadly expressed in various cell types, with particularly high expression in neurons.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35084 Product name: Recombinant human EFHD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-80 aa of BC023611 Sequence: ATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLLRRADLNQGIGEPQSPSRRVF Predict reactive species\nFull Name: EF-hand domain family, member D2\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 27-30 kDa\nGenBank Accession Number: BC023611\nGene Symbol: EFHD2\nGene ID (NCBI): 79180\nRRID: AB_3670053\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q96C19\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887431569577,"sku":"31624-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31624-1-ap","provider":"Iright","version":"1.0","type":"link"}