{"product_id":"proteintech-31626-1-ap","title":"Proteintech, 31626-1-AP, OATP1A2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OATP1A2 (31626-1-AP) by Proteintech is a Polyclonal antibody targeting OATP1A2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n31626-1-AP targets OATP1A2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, human heart tissue,  mouse heart tissue,  rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLCO1A2 also known as OATP1A2, is a member of the SLC21A family of solute carriers. SLCO1A2 encodes a sodium-independent transporter that mediates cellular uptake of organic ions in the liver(PMID: 19129463). It has been reported that SLCO1A2 detected a nonglycosylated form around 59kDa and 70-75 kDa glycosylated form(PMID: 15632119).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34497 Product name: Recombinant human SLCO1A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 406-513 aa of NM_021094 Sequence: FLMTCENSSVVGINTSYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYF Predict reactive species\nFull Name: solute carrier organic anion transporter family, member 1A2\nCalculated Molecular Weight: 670 aa, 74 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: NM_021094\nGene Symbol: SLCO1A2\nGene ID (NCBI): 6579\nRRID: AB_3670054\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P46721\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887744962729,"sku":"31626-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31626-1-ap","provider":"Iright","version":"1.0","type":"link"}