{"product_id":"proteintech-31629-1-ap","title":"Proteintech, 31629-1-AP, CRYZ Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CRYZ (31629-1-AP) by Proteintech is a Polyclonal antibody targeting CRYZ in WB, ELISA applications with reactivity to human, mouse samples\n31629-1-AP targets CRYZ in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCRYZ (Zeta-crystallin) also called quinone oxidoreductase and NADPH:quinone reductase, and it does not have alcohol dehydrogenase activity. It binds NADP and acts through a one-electron transfer process. Orthoquinones, such as 1,2-naphthoquinone or 9,10-phenanthrenequinone, are the best substrates (in vitro) for CRYZ. It may act in the detoxification of xenobiotics. CRYZ interacts with (AU)-rich elements (ARE) in the 3'-UTR of target mRNA species and enhances the stability of mRNA coding for BCL2. NADPH binding interferes with mRNA binding (PMID: 17497241; 20103721).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35066 Product name: Recombinant human CRYZ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 143-329 aa of BC039578 Sequence: SACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGATGKMILLL Predict reactive species\nFull Name: crystallin, zeta (quinone reductase)\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC039578\nGene Symbol: CRYZ\nGene ID (NCBI): 1429\nRRID: AB_3670055\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q08257\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886890733737,"sku":"31629-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31629-1-ap","provider":"Iright","version":"1.0","type":"link"}