{"product_id":"proteintech-31647-1-ap","title":"Proteintech, 31647-1-AP, C12orf29 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C12orf29 (31647-1-AP) by Proteintech is a Polyclonal antibody targeting C12orf29 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n31647-1-AP targets C12orf29 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, HeLa cells,  U-87 MG cells\nPositive IHC detected in: mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC12orf29, also known as RLIG1, is a 37 kDa human protein consisting of 325 amino acids. It catalyzes ATP-dependent RNA ligation via a three-step mechanism involving tandem auto- and RNA AMPylation (PMID: 36792600).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35681 Product name: Recombinant human C12orf29 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of NM_001009894.2 Sequence: MKRLGSVQRKMPCVFVTEVKEEPSSKREHQPFKVLATETVSHKALDADIYSAIPTEKVDGTCCYVTTYKDQPYLWARLDRKPNKQAEKRFKNFLHSKENPKEFFWNVEEDFKPAPECWIPAKETEQINGNPVPDENGHIPGWVPVEKNNK Predict reactive species\nFull Name: chromosome 12 open reading frame 29\nCalculated Molecular Weight: 37kDa，325aa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: NM_001009894.2\nGene Symbol: C12orf29\nGene ID (NCBI): 91298\nRRID: AB_3670063\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8N999\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885378261161,"sku":"31647-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31647-1-ap","provider":"Iright","version":"1.0","type":"link"}