{"product_id":"proteintech-31664-1-ap","title":"Proteintech, 31664-1-AP, INTS6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe INTS6 (31664-1-AP) by Proteintech is a Polyclonal antibody targeting INTS6 in WB, IHC, ELISA applications with reactivity to human samples\n31664-1-AP targets INTS6 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: DU 145 cells, MCF-7 cells,  HuH-7 cells,  L02 cells,  PC-3 cells,  LNCaP cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nINTS6 is a component of the Integrator (INT) complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36146 Product name: Recombinant human INTS6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 672-815 aa of BC039829 Sequence: VVNNHIGGKGPPAPTTQAQPDLIKPLPLHKISETTNDSIIHDVVENHVADQLSSDITPNAMDTEFSASSPASLLERPTNHMEALGHDHLGTNDLTVGGFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQ Predict reactive species\nFull Name: integrator complex subunit 6\nCalculated Molecular Weight: 100 kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC039829\nGene Symbol: INTS6\nGene ID (NCBI): 26512\nRRID: AB_3670067\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9UL03\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887685652649,"sku":"31664-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31664-1-ap","provider":"Iright","version":"1.0","type":"link"}