{"product_id":"proteintech-31665-1-ap","title":"Proteintech, 31665-1-AP, CDC40 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDC40 (31665-1-AP) by Proteintech is a Polyclonal antibody targeting CDC40 in WB, ELISA applications with reactivity to human samples\n31665-1-AP targets CDC40 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HUVEC cells,  HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCDC40 (cell division cycle 40), also known as EHB3. It is expected to be located in the nucleus, which is ubiquitinated in bone marrow and lymph node. The protein is required for pre-mRNA splicing as component of the activated spliceosome, and it plays an important role in embryonic brain development; this function does not require proline isomerization (PMID: 33220177; 33220177). The molecular weight of CDC40 is 65 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36151 Product name: Recombinant human CDC40 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-243 aa of BC126114 Sequence: LAVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTILHV Predict reactive species\nFull Name: cell division cycle 40 homolog (S. cerevisiae)\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC126114\nGene Symbol: CDC40\nGene ID (NCBI): 51362\nRRID: AB_3670068\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O60508\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886389416105,"sku":"31665-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31665-1-ap","provider":"Iright","version":"1.0","type":"link"}