{"product_id":"proteintech-31681-1-ap","title":"Proteintech, 31681-1-AP, INSM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe INSM1 (31681-1-AP) by Proteintech is a Polyclonal antibody targeting INSM1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n31681-1-AP targets INSM1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInsulinoma-associated-1 (INSM1) is a zinc-finger transcription factor that was originally identified in a human insulinoma subtraction library. INSM1 plays a cardinal role as a transcription factor in the differentiation of embryonic neuroendocrine cells. In situ hybridization studies of human tissues have shown the presence of the INSM1 transcript across various brain regions, as well as in endocrine organs such as the pancreas, adrenal gland, thymus, thyroid, and the endocrine cells of the gastrointestinal tract .(PMID: 34943408, PMID: 36290282)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33774 Product name: Recombinant human INSM1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-230 aa of NM_002196 Sequence: MPRGFLVKRSKKSTPVSYRVRGGEDGDRALLLSPSCGGARAEPPAPSPVPGPLPPPPPAERAHAALAAALACAPGPQPPPQGPRAAHFGNPEAAHPAPLYSPTRPVSREHEKHKYFERSFNLGSPVSAESFPTPAALLGGGGGGGASGAGGGGTCGGDPLLFAPAELKMGTAFSAGAEAARGPGPGPPLPPAAALRPPGKRPPPPTAAEPPAKAVKAPGAKKPKAIRKLH* Predict reactive species\nFull Name: insulinoma-associated 1\nCalculated Molecular Weight: 53 kDa\nObserved Molecular Weight: 53-60 kDa\nGenBank Accession Number: NM_002196\nGene Symbol: INSM1\nGene ID (NCBI): 3642\nRRID: AB_3670075\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q01101\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887685030057,"sku":"31681-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31681-1-ap","provider":"Iright","version":"1.0","type":"link"}