{"product_id":"proteintech-31692-1-ap","title":"Proteintech, 31692-1-AP, ATP2B3\/PMCA3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATP2B3\/PMCA3 (31692-1-AP) by Proteintech is a Polyclonal antibody targeting ATP2B3\/PMCA3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n31692-1-AP targets ATP2B3\/PMCA3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 37°C incubated mouse brain tissue,  37°C incubated rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP2B3 also known as PMCA3, belongs to the family of P-type primary ion transport ATPases. ATP2B3 uses ATP as an energy source to transport cytosolic Ca2+ ions across the plasma membrane to the extracellular compartment. ATP2B3 is highly expressed in the brain and cerebellum and is important in regulating neuronal Ca2+. Mutations in ATP2B3 are associated with X-linked spinocerebellar ataxia-1 (PMID: 25953895, 22912398).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35923 Product name: Recombinant human ATP2B3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-97 aa of BC047580 Sequence: MGDMANSSIEFHPKPQQQRDVPQAGGFGCTLAELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKT Predict reactive species\nFull Name: ATPase, Ca++ transporting, plasma membrane 3\nObserved Molecular Weight: 134 kDa\nGenBank Accession Number: BC047580\nGene Symbol: ATP2B3\nGene ID (NCBI): 492\nRRID: AB_3670080\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q16720\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885109989545,"sku":"31692-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31692-1-ap","provider":"Iright","version":"1.0","type":"link"}