{"product_id":"proteintech-31694-1-ap","title":"Proteintech, 31694-1-AP, FAM210A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM210A (31694-1-AP) by Proteintech is a Polyclonal antibody targeting FAM210A in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n31694-1-AP targets FAM210A in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse adipose tissue, mouse heart tissue,  rat adipose tissue\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM210A also known as C18orf19, is a determinant of bone and muscle structure and strength. FAM210A is required for cold-induced mitochondrial cristae remodeling, adaptive thermogenic activity, and brown adipose tissue characteristics(PMID: 37816711). FAM210A is localized to mitochondria and cytoplasm of muscle cells and myotubes(PMID: 29618611).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36161 Product name: Recombinant human C18orf19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 157-272 aa of NM_001098801 Sequence: LKGVNVVPFLELIGLPDSVVSILKNSQSGNALTAYALFKIATPARYTVTLGGTSVTVKYLRSHGYMSTPPPVKEYLQDRMEETKELITEKMEETKDRLTEKLQETKEKVSFKKKVE Predict reactive species\nFull Name: chromosome 18 open reading frame 19\nCalculated Molecular Weight: 30kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: NM_001098801\nGene Symbol: C18orf19\nGene ID (NCBI): 125228\nRRID: AB_3670081\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q96ND0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887632371881,"sku":"31694-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31694-1-ap","provider":"Iright","version":"1.0","type":"link"}