{"product_id":"proteintech-31696-1-ap","title":"Proteintech, 31696-1-AP, DCUN1D2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DCUN1D2 (31696-1-AP) by Proteintech is a Polyclonal antibody targeting DCUN1D2 in IP, ELISA applications with reactivity to human samples\n31696-1-AP targets DCUN1D2 in IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: PC-12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDCUN1D2 (DCN1-like protein 2), also known as DCNL2. It is predicted to be located in the cytoplasm and nucleus. Mostly expressed in liver, kidney and brain (PMID: 26906416). Contributes to the neddylation of all cullins by transferring NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes and plays an essential role in the regulation of SCF (SKP1-CUL1-F-box protein)-type complexes activity (PMID: 19617556). The molecular weight of DCUN1D2 is 30 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36310 Product name: Recombinant human DCUN1D2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 16-73 aa of BC056669 Sequence: MACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRYK Predict reactive species\nFull Name: DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae)\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC056669\nGene Symbol: DCUN1D2\nGene ID (NCBI): 55208\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q6PH85\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887096090793,"sku":"31696-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31696-1-ap","provider":"Iright","version":"1.0","type":"link"}