{"product_id":"proteintech-31704-1-ap","title":"Proteintech, 31704-1-AP, CSDA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CSDA (31704-1-AP) by Proteintech is a Polyclonal antibody targeting CSDA in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n31704-1-AP targets CSDA in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, KYSE-30 cells,  mouse liver tissue,  mouse skeletal muscle tissue\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCSDA (Cold shock domain protein A), also known as DBPA (DNA-binding protein A), YBX3 (Y-box protein 3), is a DNA-binding protein that represses angiogenesis and lymphangiogenesis by directly binding to hypoxia response element (HRE) and serum response element (SRE). CSDA is ubiquitous expressed in human skeletal muscle, heart, and decidual cells, which is thought to a multifunctional epithelial-specific protein involved in gene transcription, DNA repair, and interaction with other proteins (PMID: 33816248). CSDA is a nucleic-acid-binding protein that directly regulates gene expression by using different mechanisms, and acts as a translational repressor (e.g., MYH9 and SPTBN1) and positive regulator of mRNA stability (PMID: 31189097). Western blot analysis detected CDSA at a range of 50~70 kDa due to the anomalous mobility of Y-box proteins (PMID: 38255791).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36519 Product name: Recombinant human CSDA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 78-175 aa of BC008801 Sequence: GSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRR Predict reactive species\nFull Name: cold shock domain protein A\nCalculated Molecular Weight: 40 kDa\nObserved Molecular Weight: 60-68 kDa\nGenBank Accession Number: BC008801\nGene Symbol: CSDA\nGene ID (NCBI): 8531\nRRID: AB_3670088\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P16989\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886897418409,"sku":"31704-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31704-1-ap","provider":"Iright","version":"1.0","type":"link"}