{"product_id":"proteintech-31728-1-ap","title":"Proteintech, 31728-1-AP, TMEM208 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM208 (31728-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM208 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n31728-1-AP targets TMEM208 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 37°C incubated mouse brain tissue, 37°C incubated rat brain tissue\nPositive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTransmembrane protein 208 (TMEM208) can regulate both autophagy and ER stress. When overexpressed, TMEM208 impaired autophagy as characterized by the decrease of the accumulation of LC3-II, decreased degradation of autophagic substrates, and reduced expression of critical effectors and vital molecules of the ER stress and autophagy processes. (PMID: 23691174)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35668 Product name: Recombinant human TMEM208 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 130-173 aa of BC003080 Sequence: PGRALYLLWVNVLGPWFTADSGTPAPEHNEKRQRRQERRQMKRL Predict reactive species\nFull Name: transmembrane protein 208\nCalculated Molecular Weight: 173 aa, 20 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC003080\nGene Symbol: TMEM208\nGene ID (NCBI): 29100\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BTX3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887831797929,"sku":"31728-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31728-1-ap","provider":"Iright","version":"1.0","type":"link"}