{"product_id":"proteintech-31730-1-ap","title":"Proteintech, 31730-1-AP, PDE4B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PDE4B (31730-1-AP) by Proteintech is a Polyclonal antibody targeting PDE4B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n31730-1-AP targets PDE4B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse brain tissue,  rat brain tissue\nPositive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPDE4B, also known as DPDE4, is a member of the PDE family of type IV cAMP-specific cyclic nucleotides. PDE4B regulates the cellular concentration of cyclic nucleotides and thus plays a role in signal transduction of inflammatory factors. Among all subtypes of PDE4, PDE4B is closely associated with cancer and has a major contribution to the role in hematological malignancies. PDE4B is distributed in multiple tissues, especially myeloid cells (PMID: 35899614, PMID: 36278172).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35552 Product name: Recombinant human PDE4B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 651-736 aa of BC105040 Sequence: WYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVIDPENRDSLGETDIDIATEDKSPVDT Predict reactive species\nFull Name: phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila)\nCalculated Molecular Weight: 736 aa, 83 kDa\nObserved Molecular Weight: 83 kDa\nGenBank Accession Number: BC105040\nGene Symbol: PDE4B\nGene ID (NCBI): 5142\nRRID: AB_3670101\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q07343\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887754924201,"sku":"31730-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31730-1-ap","provider":"Iright","version":"1.0","type":"link"}