{"product_id":"proteintech-31736-1-ap","title":"Proteintech, 31736-1-AP, Pannexin 3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Pannexin 3 (31736-1-AP) by Proteintech is a Polyclonal antibody targeting Pannexin 3 in WB, ELISA applications with reactivity to human samples\n31736-1-AP targets Pannexin 3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPannexin 3 (PANX3) is a member of the pannexin family of single membrane channel-forming glycoproteins. PANX3 is expressed in osteoblasts, chondrocytes, and skin and plays a major role in calcium homeostasis suggesting an independent functional niche. PANX3 regulates both chondrocyte and osteoblast differentiation via the activation of intracellular Ca2+ signaling pathways through multiple channel activities: hemichannels, endoplasmic reticulum (ER) Ca2+ channels, and gap junctions. PANX3 has 392 amino acids with a molecular weight of ~ 43 kDa and is N-linked glycosylated at asparagine residue 71 in the first extracellular loop (PMID: 27837015, PMID: 34250568, PMID: 38580658).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34451 Product name: Recombinant human PANX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 289-392 aa of NM_052959 Sequence: YNLTRLCRWDKRLLSVYEMLPAFDLLSRKMLGCPINDLNVILLFLRANISELISFSWLSVLCVLKDTTTQKHNIDTVVDFMTLLAGLEPSKPKHLTNSACDEHP Predict reactive species\nFull Name: pannexin 3\nCalculated Molecular Weight: 392 aa, 45 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: NM_052959\nGene Symbol: PANX3\nGene ID (NCBI): 116337\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q96QZ0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887750434985,"sku":"31736-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31736-1-ap","provider":"Iright","version":"1.0","type":"link"}