{"product_id":"proteintech-31740-1-ap","title":"Proteintech, 31740-1-AP, MDFIC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MDFIC (31740-1-AP) by Proteintech is a Polyclonal antibody targeting MDFIC in IF\/ICC, IP, ELISA applications with reactivity to human samples\n31740-1-AP targets MDFIC in IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: Kasumi-1 cells\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMDFIC encodes the MyoD family inhibitor domain containing protein, a 246-amino acid protein documented to regulate the activity of transcription factors including the glucocorticoid recep tor (GR), HAND1, and T cell factor\/lymphoid enhancer factor (TCF\/LEF) family members. The C-terminal region of MDFIC harbors a domain extremely rich in cysteine residues, reported to mediate protein-protein interactions between MDFIC and transcription factor componentry (PMID: 35235341).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35437 Product name: Recombinant human MDFIC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of NM_001166345 Sequence: MSGAGEALAPGPVGPQRVAEAGGGQLGSTAQGKCDKDNTEKDITQATNSHFTHGEMQDQSIWGNPSDGELIRTQPQRLPQLQTSAQVPSGEEIGKIKNGHTGLSNGNGIHHGAKHGSADNRKLSAPVSQKMHRKIQSSLSVNSDISKKSKVNAVFSQKTGSSPEDCCVHC Predict reactive species\nFull Name: MyoD family inhibitor domain containing\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: NM_001166345\nGene Symbol: MDFIC\nGene ID (NCBI): 29969\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9P1T7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887715307689,"sku":"31740-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31740-1-ap","provider":"Iright","version":"1.0","type":"link"}