{"product_id":"proteintech-31759-1-ap","title":"Proteintech, 31759-1-AP, MEIKIN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MEIKIN (31759-1-AP) by Proteintech is a Polyclonal antibody targeting MEIKIN in IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human samples\n31759-1-AP targets MEIKIN in IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\nPositive IF\/ICC detected in: MDCK cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMeikin is a conservative regulatory protein that plays a key role in meiosis. It was first discovered in mice. It is a meiotic-specific centromere protein and was named Meikin because of its important role in meiosis. Meikin's function is mainly realized by regulating the activity of Polo-like kinase PLK1. PLK1 is enriched to centromere under Meikin's dependence, which further affects the function of centromere.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36937 Product name: Recombinant human MEIKIN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-113 aa of NM_001303622 Sequence: MWPLRVYTRKKREGQRLNLTPTPDLGSPAKAEAPPGSKRKGKVHGLSKIAEKAERSRQGGSGSGPFSPRLGVTGEKSLQENRSSEDTQDEKIASLRESVTDDLQVDSSSSNSE Predict reactive species\nFull Name: similar to mCG13783\nCalculated Molecular Weight: 373aa, 41 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: NM_001303622\nGene Symbol: LOC728637\nGene ID (NCBI): 728637\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: A0A087WXM9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887716847785,"sku":"31759-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31759-1-ap","provider":"Iright","version":"1.0","type":"link"}