{"product_id":"proteintech-31791-1-ap","title":"Proteintech, 31791-1-AP, C3orf37 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C3orf37 (31791-1-AP) by Proteintech is a Polyclonal antibody targeting C3orf37 in WB, ELISA applications with reactivity to human, mouse, rat samples\n31791-1-AP targets C3orf37 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat testis tissue, HEK-293T cells,  MCF-7 cells,  mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHMCES, also known as C3orf37, is a protein that is associated with the protection of abasic sites. The molecular mass of HMCES is 40 kDa and it recognizes AP sites in ssDNA at replication forks and chemically modifies the lesion to generate a DNA-protein crosslink (PMID: 30554877).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36362 Product name: Recombinant human C3orf37 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-300 aa of BC009993 Sequence: DTVMEKRSFKVPLGKGRRCVVLADGFYEWQRCQGTNQRQPYFIYFPQIKTEKSGSIGAADSPENWEKVWDNWRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIHHRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNSRNNTPECLAPVDLVVKKELRASGSSQRMLQWLATKSPKKED Predict reactive species\nFull Name: chromosome 3 open reading frame 37\nObserved Molecular Weight: 36 kDa\nGenBank Accession Number: BC009993\nGene Symbol: C3orf37\nGene ID (NCBI): 56941\nRRID: AB_3670114\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q96FZ2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885609996457,"sku":"31791-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31791-1-ap","provider":"Iright","version":"1.0","type":"link"}