{"product_id":"proteintech-31793-1-ap","title":"Proteintech, 31793-1-AP, PON3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PON3 (31793-1-AP) by Proteintech is a Polyclonal antibody targeting PON3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n31793-1-AP targets PON3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HepG2 cells,  mouse liver tissue,  rat liver tissue\nPositive IHC detected in: human liver tissue, mouse liver tissue,  rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPON3, a member of the paraoxonase family, is expressed primarily in the liver and encodes a protein that is secreted into the bloodstream and binds to high-density lipoprotein (HDL). It also rapidly hydrolyzes lactones and inhibits the oxidation of low-density lipoprotein (LDL), thereby slowing the onset and progression of atherosclerosis. In addition, PON3 is closely associated with hepatocellular carcinoma (HCC), and is a potential therapeutic target for HCC by inducing cell cycle arrest and further inhibiting HCC cell proliferation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36602 Product name: Recombinant human PON3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-167 aa of NM_000940.2 Sequence: AFRERVNASREVEPVEPENCHLIEELESGSEDIDILPSGLAFISSGLKYPGMPNFAPDEPGKIFLMDLNEQNPRAQALEISGGFDKELFNPHGISIFIDKDNTVYLYVVNHPHMKSTVEIFKFEEQQRSLVYLKTIKHELLKSVN Predict reactive species\nFull Name: paraoxonase 3\nCalculated Molecular Weight: NM_000940.2 40kDa，354aa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: NM_000940.2\nGene Symbol: PON3\nGene ID (NCBI): 5446\nRRID: AB_3670115\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q15166\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887768490153,"sku":"31793-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31793-1-ap","provider":"Iright","version":"1.0","type":"link"}