{"product_id":"proteintech-31840-1-ap","title":"Proteintech, 31840-1-AP, TATDN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TATDN1 (31840-1-AP) by Proteintech is a Polyclonal antibody targeting TATDN1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n31840-1-AP targets TATDN1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, BEAS-2B cells,  A431 cell,  A549 cell\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHomo sapiens TatD DNase domain containing 1 (TATDN1), a member of the TATD family, is a highly conserved nuclease in both prokaryotes and eukaryotes with depurine\/apyrimidine (AP) endonuclease activity, which plays an extremely important role in the genesis and prognosis of malignant tumors such as NSCLC and breast cancer, and is a potential therapeutic target for NSCLC patients who have failed to undergo cisplatin therapy (DDP) in vivo.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36040 Product name: Recombinant human TATDN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC064964 Sequence: MSRFKFIDIGINLTDPMFRGIYRGVQKHQDDLQDVIGRAVEIGVKKFMITGGNLQDSKDALHLAQTNGMFFSTVGCHPTRCGEFEKNNPDLYLKELLNLAENNKGKVVAIGECGLDFDRLQFCPKDTQLKYFEKQFELSEQTKLPMFLHCRNSHAEFLDITKRNRDRCVGGVVHSFDGTKEAAAALIDLDLYIGFNGCSL Predict reactive species\nFull Name: TatD DNase domain containing 1\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC064964\nGene Symbol: TATDN1\nGene ID (NCBI): 83940\nRRID: AB_3670124\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q6P1N9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887823147177,"sku":"31840-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31840-1-ap","provider":"Iright","version":"1.0","type":"link"}