{"product_id":"proteintech-31900-1-ap","title":"Proteintech, 31900-1-AP, KCNA6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KCNA6 (31900-1-AP) by Proteintech is a Polyclonal antibody targeting KCNA6 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n31900-1-AP targets KCNA6 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, Jurkat cells,  Raji cells,  TT cells,  U2OS cells\nPositive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Shaker-like Kv1 potassium channel family comprises 8 α subunits (Kv1.1-Kv1.8), which are key regulators of neuronal excitability in mammals (PMID: 7842011; 9581771; 22612818). Potassium voltage-gated channel subfamily A member 6 (KCNA6, also known as HBK2, Kv1.6, and PPP1R96) is a multi-pass membrane protein that is mainly expressed in the central and peripheral nervous system (PMID: 12042352; 8872310). The concentration of the Kv1.6 channel in the cell membrane can modulate the kinetic properties of Kv1.6-induced K+ current (PMID: 14575698).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35654 Product name: Recombinant human KCNA6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 194-262 aa of NM_002235.3 Sequence: ETLPQFRVDGRGGNNGGVSRVSPVSRGSQEEEEDEDDSYTFHHGITPGEMGTGGSSSLSTLGGSFFTDP Predict reactive species\nFull Name: potassium voltage-gated channel, shaker-related subfamily, member 6\nCalculated Molecular Weight: 59 kDa，529aa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: NM_002235.3\nGene Symbol: KCNA6\nGene ID (NCBI): 3742\nRRID: AB_3670137\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P17658\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887690797225,"sku":"31900-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31900-1-ap","provider":"Iright","version":"1.0","type":"link"}