{"product_id":"proteintech-31915-1-ap","title":"Proteintech, 31915-1-AP, SASH3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SASH3 (31915-1-AP) by Proteintech is a Polyclonal antibody targeting SASH3 in WB, ELISA applications with reactivity to human samples\n31915-1-AP targets SASH3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells, Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSterile alpha motif (SAM) and Src homology-3 (SH3) domain-containing 3 (SASH3), also called SH3-containing lymphocyte protein (SLY1), is a putative adaptor protein that is postulated to play an important role in the organization of signaling complexes and propagation of signal transduction cascades in lymphocytes.  The SASH3 gene is located on the X-chromosome, which plays an important role in human lymphocyte function and survival (PMID: 33876203).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36154 Product name: Recombinant human SASH3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 230-380 aa of BC051881 Sequence: DVLPEEAVGHARPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGSEEAEEGAESSQEPVAHTVSEPKVDIPRDSGCFEGSESGRDDAELAGTEEQLQGLSLAGAP Predict reactive species\nFull Name: SAM and SH3 domain containing 3\nCalculated Molecular Weight: 380 aa, 42 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC051881\nGene Symbol: SASH3\nGene ID (NCBI): 54440\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O75995\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887792705705,"sku":"31915-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31915-1-ap","provider":"Iright","version":"1.0","type":"link"}