{"product_id":"proteintech-31930-1-ap","title":"Proteintech, 31930-1-AP, KIR2DL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KIR2DL2 (31930-1-AP) by Proteintech is a Polyclonal antibody targeting KIR2DL2 in WB, ELISA applications with reactivity to human samples\n31930-1-AP targets KIR2DL2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HuT 78 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKIR2DL2 is one of killer cell immunoglobulin-like receptors, which are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells.  KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules;  thus, KIR proteins are thought to play an important role in regulation of the immune response.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35284 Product name: Recombinant human KIR2DL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-245 aa of NM_014219 Sequence: HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLH Predict reactive species\nFull Name: killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 2\nCalculated Molecular Weight: 38 kDa\nObserved Molecular Weight: 60,30 kDa\nGenBank Accession Number: NM_014219\nGene Symbol: KIR2DL2\nGene ID (NCBI): 3803\nRRID: AB_3670150\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P43627\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887696662697,"sku":"31930-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31930-1-ap","provider":"Iright","version":"1.0","type":"link"}