{"product_id":"proteintech-31934-1-ap","title":"Proteintech, 31934-1-AP, ZNF787 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF787 (31934-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF787 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n31934-1-AP targets ZNF787 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  Jurkat cells,  U-251 cells,  RT-4 cells,  NIH\/3T3 cells\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZinc finger protein 787 (ZNF787, also known as TIP20) is activated in the nucleus and may be involved in transcriptional regulation. It probably is one repressor of neuronal features and can interact with histone deacetylase 1 (HDAC1) in regulating the permeability of the blood-brain barrier (BBB) as well as the pathogenesis of Alzheimer's disease (PMID: 33057419; 38329647).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36052 Product name: Recombinant human ZNF787 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC077728 Sequence: MELREEAWSPGPLDSEDQQMASHENPVDILIMDDDDVPSWPPTKLSPPQS Predict reactive species\nFull Name: zinc finger protein 787\nCalculated Molecular Weight: 40 kDa\nObserved Molecular Weight: 40-50 kDa\nGenBank Accession Number: BC077728\nGene Symbol: ZNF787\nGene ID (NCBI): 126208\nRRID: AB_3670151\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q6DD87\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868837761193,"sku":"31934-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31934-1-ap","provider":"Iright","version":"1.0","type":"link"}