{"product_id":"proteintech-31947-1-ap","title":"Proteintech, 31947-1-AP, CD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD2 (31947-1-AP) by Proteintech is a Polyclonal antibody targeting CD2 in WB, IF\/ICC, ELISA applications with reactivity to mouse, rat samples\n31947-1-AP targets CD2 in WB, IF\/ICC, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: CTLL-2 cells, mouse spleen tissue,  mouse thymus tissue,  rat spleen tissue,  rat thymus tissue\nPositive IF\/ICC detected in: EL-4 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD2 is a cell surface glycoprotein present on a majority of thymocytes, all mature T cells and subset of NK cells but not on B lymphocytes. It is a pan T-cell marker. CD2 interacts with lymphocyte function-associated antigen (LFA-3\/CD58) and CD48\/BCM1 to mediate adhesion between T-cells and other cell types. CD2 is implicated in the triggering of T-cells, the cytoplasmic domain is implicated in the signaling function.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg1403 Product name: Recombinant Mouse CD2 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 23-203 aa of NM_013486.2 Sequence: RDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPMIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLNAPFKCEAINPVSKESKMEVVNCPEKGLS Predict reactive species\nFull Name: CD2 antigen\nCalculated Molecular Weight: 38 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: NM_013486.2\nGene Symbol: CD2\nGene ID (NCBI): 12481\nRRID: AB_3670154\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P08920\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886122848425,"sku":"31947-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31947-1-ap","provider":"Iright","version":"1.0","type":"link"}